SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004007 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004007
Domain Number 1 Region: 134-373
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.38e-37
Family L-arabinose binding protein-like 0.015
Further Details:      
 
Domain Number 2 Region: 385-462
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.37e-16
Family Phosphate binding protein-like 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004007   Gene: ENSOPRG00000004341   Transcript: ENSOPRT00000004348
Sequence length 629
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3032:8771:202725:1 gene:ENSOPRG00000004341 transcript:ENSOPRT00000004348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLFIRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVPHVDNIETANSFAVTNAXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLEELDRRQEKKFV
IDCEIERLQNILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTP
MVTKLMDRWKKLDQREYPGSETPPKYTSALTYDGVLVMAETFRNLRKQKIDISRRGNAGD
CLANPAAPWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELKSTGPRKVGYW
NDMDKLVLIQDVPTLGNDTAAIENRTVVVTTIMESPYVMYKKNHEMFEGNDKYEGYCVDL
ASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWFTL
IIISSYTANLAAFLTIERMVSPIGSAEDL
Download sequence
Identical sequences ENSOPRP00000004007 ENSOPRP00000004007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]