SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004011 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004011
Domain Number 1 Region: 14-97,138-278,426-518
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 7.85e-29
Family Quinoprotein alcohol dehydrogenase-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004011   Gene: ENSOPRG00000004336   Transcript: ENSOPRT00000004352
Sequence length 762
Comment pep:novel genescaffold:pika:GeneScaffold_338:43770:208627:-1 gene:ENSOPRG00000004336 transcript:ENSOPRT00000004352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QELVSCVGWTTAEELYSCSDDHQIVKWNLLTSETSQIVKLPDDIHPIDLHWFPKTFGVKK
QTQAESFVLTSSDGKFHLISKLGRVEKSVEAHCGAVLAGRWNYEGTALVTXXXXXXXXXX
XXXXXXXXXXXXXXTPVYSVAWGPDSEKVLYTAGKQLIIKPLQPNAKVLQWKAHDGIILK
VDWNSVNDLILSAGEDCKYKVWDSYGRLLYSSQPHEHPITSVAWAPDGELFAVGSFHTLR
LCDKTGWSYALEKPNTGSIFNIAWSVDGTQIAGACGNGHVVFAHVVEQRWEWKNFQVTLT
KRRTMQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTKNWNTPLIFDLKE
GTVSLILQAEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIKD
KADEKLIFLFEATTGKPLGDGKFLSHKNEILEIALDQKGLTHDRKIAFIDKNRDLYITSV
KRFGKEEQIIKLGTMVHTLAWCDTCNILAGLQDTRLTVWYYPHTVYVDRDILSKTLYEKD
ASEFSKNPHIVSFVGNQITIRRADGSLVHISISPYPAILHEYVSSSKWDDAVRLCRFVKE
QSMGTALVVKAVANQDMTSAEIAYAAIGEIDKVQYINSIKDLPSKESKLAHILMFSGNIQ
EAEAVLLQAGLVYQAIQINIKLYNWEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXLLIDWDKIKAKIELEITKERERSSQASKAVGLKH
Download sequence
Identical sequences ENSOPRP00000004011 ENSOPRP00000004011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]