SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004013 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004013
Domain Number 1 Region: 373-454
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 9.95e-20
Family HLH, helix-loop-helix DNA-binding domain 0.0000979
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004013   Gene: ENSOPRG00000004369   Transcript: ENSOPRT00000004354
Sequence length 459
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1610:1289031:1292180:1 gene:ENSOPRG00000004369 transcript:ENSOPRT00000004354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSCTASTMPGMIRKNADLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPP
LSPSRAFPDHSPEPSNWATELLLPEADLWGNPAEEDAFGLGGLGGLTPNPVILQDCMWSG
FSAREKLERAVSEKLQHGRAPPAAGPAAPSPGVGAASSGGRGHGGAAGTGRAAATLPAEL
AHPAAECVDPAVVFPFPVNKREPAAVSAAPALGAPGTASVCASGASSAVAAGPPTPAPPR
AGGGDPKALSTSGEDTLSDSXXXXXXXXXXXXXIDVVTVEKRRSSSSSKSVTTYTITVRP
KSTALGRVQASELILKRCVPIHQQHNYAAPSPYVESEDAPPQKKVKSEVSPRHLKNLVPP
KAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLALRGHVPELVKNEKAAKVVILKK
ATEYVHSLQAEEHQLLLEKEKLQARQQQLLKKIEHARTC
Download sequence
Identical sequences ENSOPRP00000004013 ENSOPRP00000004013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]