SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004121 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004121
Domain Number 1 Region: 259-522
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.73e-84
Family Eukaryotic proteases 0.0000000134
Further Details:      
 
Domain Number 2 Region: 66-174
Classification Level Classification E-value
Superfamily Kringle-like 5.07e-31
Family Kringle modules 0.00018
Further Details:      
 
Domain Number 3 Region: 1-46
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000586
Family Fibronectin type I module 0.00086
Further Details:      
 
Domain Number 4 Region: 230-259
Classification Level Classification E-value
Superfamily Kringle-like 0.00000628
Family Kringle modules 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004121   Gene: ENSOPRG00000004480   Transcript: ENSOPRT00000004475
Sequence length 523
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_362:18906:28089:-1 gene:ENSOPRG00000004480 transcript:ENSOPRT00000004475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TCVEQRMQLTFQLLESWLRPALRSNRVEYCRCTSSGPRCHSVPVKSCSEPRCLNGGTCWQ
AQHFSDFVCQCPEGFVGKRCDVDTRTKCYRDKGIGYRGTWSTSESGAECVNWNSKWLVMK
PYNGRRPNAPQLGLGNHNYCRNPDKDVKPWCYIFKTGTYIPEFCSTPICPKXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNPNGAAKPWCH
VWKNRRPMREFCDVPQCATCGLREDKQPQPRIKGGLYADITAHPWQAAIFTNHRRSPGER
FLCGGILIGSCWVLSAAHCFQDSFPQQRLKVVLGRTYTLAPAPQEQTFEVEKYTVHKEFD
DNTFDNDIALLKLKSASSSCAQESLYVRPVCLPEASLQLQDWTECELSGYGKHEESSLYY
SEQLKEAHVRLYPANRCTPQYLRNRTVTDNMLCAGDTRTGGNEVNLHDACKGDSGGPLVC
MKDGHMILLGIISWGEGCGEKDLPGVYTKVTNYLNWIQQHMKP
Download sequence
Identical sequences ENSOPRP00000004121 ENSOPRP00000004121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]