SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004131 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004131
Domain Number 1 Region: 679-1036
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.11e-86
Family alpha-mannosidase, C-terminal domain 0.071
Further Details:      
 
Domain Number 2 Region: 248-514
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 6.67e-82
Family alpha-mannosidase 0.012
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000004131
Domain Number - Region: 75-116
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0264
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004131   Gene: ENSOPRG00000004439   Transcript: ENSOPRT00000004487
Sequence length 1041
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2505:5422:15189:-1 gene:ENSOPRG00000004439 transcript:ENSOPRT00000004487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAPPLKHWRTTLERVEKFVSPLYFTDCNLRGRLFGERFPVSALSSFLTPERLSYQEAV
QRDFSPAQVGDSFEPTGGTCWFRVELNIPKAWVGREVHLCWESDGEGLVWRNGEPAQXXX
XXXXXXXXXXXXXXXXXXXXXLTLYVEVACNGLLGAGKGSMIAAPDPNKTFQLSRAELAV
FHRDVHRLLVDLELLLGMAKGLGQDNQRSFQALYTANQMVNMCDPSKPETFPAAQALASR
FFSQHGGESQHTLHAMGHCHIDTAWLWPFKETVRKCARSWVTAVQLMERNPDFIFTCSQA
QQLDWVKSRYPGLHARLQEFACRGQFVPVGGTWVEMDGNLPSGEAMVRQFLEGQNFFLQE
FGRRCSEFWLPDTFGYSAQLPQIMRGCGLERFLTQKLSWNLVNSFPHHTFFWEGLDGSRV
LVHFPPGDSYGMQGTVEEVLKTVTNNRDKGRANHSAFLFGFGDGGGGPTQTMLDRLKRLD
HTDGLPRVQLSSPEQLFSALECDSERLCTWIDELLWELHNGTYTTHAQXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXCSPAAQQVVVQESDGSVTLDNGILRVRLDPTGRLTSLLLVDSGREVI
AEGAVGNQFVLFDDVPLYWDAWDVMDYHLETRKPVLGQPGTLAVGVEGGLRGSAWFLLQL
SPSSRLSQEVVLDIGCPYVHFHTEVHWHEAHKFLKVEFPARVRSPHATYEIQFGHLQRPT
HRNTSWDWARFEVWAHRWLDLSEHGFGLALLNDCKYGASVHGNVLSLSLLRAPKSPDATV
DMGRHEFTYALMPHKGSFQDAGVIQAAYNLNFPLLPLSVPGPAPATAWSAFSLSSQDVVL
ETVKQAESCPRALVLRMYEAHGSHVDCWLHTALPVQEAIPCDLLERRDPAGPLPLEDGRL
KLTFSPFQVRSLILVLQPPLS
Download sequence
Identical sequences ENSOPRP00000004131 ENSOPRP00000004131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]