SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004158 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004158
Domain Number 1 Region: 187-302
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 1.12e-35
Family eIF-2-alpha, C-terminal domain 0.00000122
Further Details:      
 
Domain Number 2 Region: 90-183
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 1.31e-33
Family eIF2alpha middle domain-like 0.00000188
Further Details:      
 
Domain Number 3 Region: 11-93
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.43e-17
Family Cold shock DNA-binding domain-like 0.0000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004158   Gene: ENSOPRG00000004520   Transcript: ENSOPRT00000004517
Sequence length 314
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_390:205652:217024:1 gene:ENSOPRG00000004520 transcript:ENSOPRT00000004517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI
NRRLTPQAVKIRADIEVACYGTEGIDAIGALAAGLDCSTKTMPXXINLIAPPRYVMTTTT
LERTEGLSVLNQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQLERLERENAEVD
GDDDAEEMEAKAED
Download sequence
Identical sequences ENSOPRP00000004158 ENSOPRP00000004158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]