SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004235 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004235
Domain Number 1 Region: 28-516
Classification Level Classification E-value
Superfamily ALDH-like 1.83e-142
Family ALDH-like 0.000000499
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004235   Gene: ENSOPRG00000004594   Transcript: ENSOPRT00000004598
Sequence length 533
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2493:59291:76028:-1 gene:ENSOPRG00000004594 transcript:ENSOPRT00000004598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVVAAAAVRARILQVSSKVNYSWHPASSFSSSVPTVKLFIDGKFIESKSDKWIDIHNP
ATNEVIGRVPHSTKAEMDAAVASCKRAFPAWADTSILSRQQVLLRYQQLIKENLKEIAKL
ITLEQGKTLADAEGDVFRGLQVVEHACSVTSLMLGETMPSITKDMDLYSYRLPLGVCAGI
APFNFPAMIPLWMFPMAMVCGNTFLMKPSERVPGATMLLAKLLQDSGAPDGTLNIIHGQH
EAVNFICDNPDIKAISFVGSNQAGEYIFERGSRNGKRVQANMGAKNHGVVMPDANKENTL
NQLVGAAFGAAGQRCMALSTAILVGEARKWLPELVERAKNLRVNAGDQPGADLGPLITPQ
AKERVCNLIESGPKEGASILLDGRKIKVKGYENGNFVGPTIISNVKPNMTCYKEEIFGPV
LVVLETETLDEAIKIVNDNPYGNGTAIFTTNGATARKYSHLVDVGQVGVNVPIPVPLPMF
SFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQWKEEDATLSTPAVVMPTMGR
Download sequence
Identical sequences ENSOPRP00000004235 ENSOPRP00000004235 XP_004584458.1.84141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]