SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004403 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004403
Domain Number 1 Region: 94-153
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.66e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004403   Gene: ENSOPRG00000004802   Transcript: ENSOPRT00000004782
Sequence length 181
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3747:441605:442150:-1 gene:ENSOPRG00000004802 transcript:ENSOPRT00000004782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMENRSYSDAPDKLPTFSNSAHSPLSRSFYLDPMVPFHLCPETPGPSPYSEELPWLPFPG
DSLITDNYSEPYPLPFPMPYPSYRRCDYSYGPAFIRKRNERERQRVKCVNEGYAQLRLHL
PEEYLEKRLSKVETLRAAIKYINHLQSLLHPDKASTTNSPGTGSSIVAPSSCQLDPIFRI
V
Download sequence
Identical sequences ENSOPRP00000004403 ENSOPRP00000004403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]