SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004745 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004745
Domain Number 1 Region: 72-123
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000497
Family HLH, helix-loop-helix DNA-binding domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004745   Gene: ENSOPRG00000005163   Transcript: ENSOPRT00000005163
Sequence length 194
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4441:351015:355261:-1 gene:ENSOPRG00000005163 transcript:ENSOPRT00000005163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFALLRPVGAHVLYPDVRLLSEDEENRSESDASDQSFGCCEGLEAARSPGPGGGRRAAG
AGPVVVVRQRQAANARRDRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYIAHLG
NVLLLGDAADDEEPCFRAAVRAKSSVLFATVDGRQPRSICPFCLSHPRKGGGRRDLGGSC
LKVRGVTPLRGPRR
Download sequence
Identical sequences ENSOPRP00000004745 ENSOPRP00000004745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]