SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004793 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004793
Domain Number 1 Region: 419-907
Classification Level Classification E-value
Superfamily ALDH-like 1.35e-144
Family ALDH-like 0.00000000176
Further Details:      
 
Domain Number 2 Region: 7-206
Classification Level Classification E-value
Superfamily Formyltransferase 2.09e-51
Family Formyltransferase 0.00000000305
Further Details:      
 
Domain Number 3 Region: 211-312
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 2.83e-25
Family Post formyltransferase domain 0.00000207
Further Details:      
 
Domain Number 4 Region: 330-407
Classification Level Classification E-value
Superfamily ACP-like 0.0000288
Family Acyl-carrier protein (ACP) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004793   Gene: ENSOPRG00000005209   Transcript: ENSOPRT00000005215
Sequence length 908
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2725:3206:36052:-1 gene:ENSOPRG00000005209 transcript:ENSOPRT00000005215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PADPAAMKIAVIGQSLFGQEVYCHLRKDGHEVVGVFTVPDKDGKADPLGLEAEKDGVPVF
KFPRWRARGQALPDVVAKYQALGAELNVLPFCSQFIPMEVINAPRHGSIIYHPSLLPRHR
GASAINWTLIHGDKKGGFTIFWADDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGVK
GMVQAVRLIAEGKAPRLPQPAEGATYEGIQKKETAQINWEQPAEAIHNWIRGNDKVPGAW
TEACGQKLTFFNSTLNVPGSVPEGEPLPIPGARRPGLVTKAGLILFGNDDRMLLVKNIQL
EDGKMLPASHFFKGAASSALELTEEELAMAEAVRSTWRRILPNVPEVEDATDFFKSGAAS
VDVVRLVEEVKELCDGLELENEDVYMATTFGEFTQLLVRKLRREDGEDECVIDYVEKTVK
KLTVRVPHQLFIGGEFVDAEGNKTYDTINPTDESVLCQVSLAQLSDVDKAVAAAKDAFEN
GLWGKISARDRGRLLYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFA
GWCDKIQGSTIPINHARPNRNLTLTRKEPVGVCGIVIPWNYPLMMLSWKTAACLAAGNTV
VIKPAQVTPLTALKFAELTLKAGIPKGVVNVLPGSXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXCAVSNVKKVSLELGGKSPLIIFADCDLGKAVQMGMSSVFFNKGENCIAAGRLF
VEDSIHDQFVQKVVEEVGKMKIGDPLDRATNHGPQNHQAHLRKLLEYCQRGVKEGATLVC
GGSQVPRPGFFFEPTIFTDVEDHMFIAKEESFGPVMIISRFADGDIDAVLARANATEFGL
ASGVFTKDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLR
IKTVTFEY
Download sequence
Identical sequences ENSOPRP00000004793 ENSOPRP00000004793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]