SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004836 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004836
Domain Number 1 Region: 201-318
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.44e-22
Family Ypt/Rab-GAP domain of gyp1p 0.0057
Further Details:      
 
Domain Number 2 Region: 32-223
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.14e-19
Family Ypt/Rab-GAP domain of gyp1p 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004836   Gene: ENSOPRG00000005265   Transcript: ENSOPRT00000005262
Sequence length 335
Comment pep:known_by_projection scaffold:pika:scaffold_3522:210691:219934:1 gene:ENSOPRG00000005265 transcript:ENSOPRT00000005262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTLSPENSLSARSSASFILVKRKPPIDKTEWNSFFDENGQLAKPRDFICVNILERGLHP
FVRTEAWKFLTGYYSWQSFQDERLVDSTRRKNYEALCQTYEKLQPLLENLHCNFVETRNS
ISCDIKKLYDKDPLGNVLIDKKRLEKVLLLGYVCNTQAEYQHGFHEMAMLFQLMVEHDHE
TFWLFQFFLQKTEHSCVISIGVGRNLDMLSTLISFLDPVYAEHLKGKGAGALQSLFPWFC
LCFQRAFKSFDDVWRLWEVLLAGKPCRNFQVLVAYSMLQMVREQVLLHSMSGDDILLACN
NLVDLDADELISAACMVYAELIQKEIPEPLKDFLL
Download sequence
Identical sequences ENSOPRP00000004836 ENSOPRP00000004836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]