SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004896 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004896
Domain Number 1 Region: 53-108,145-221,381-418
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000196
Family Quinoprotein alcohol dehydrogenase-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004896   Gene: ENSOPRG00000005335   Transcript: ENSOPRT00000005332
Sequence length 551
Comment pep:novel genescaffold:pika:GeneScaffold_3825:6099:11948:1 gene:ENSOPRG00000005335 transcript:ENSOPRT00000005332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMDNKDLEAESHPLKSEDRKSKQSPGNRVKAEDRLPRSPAQSRLSRCRAVAFFLSLFLCL
FVVFVVSFIIPCPDRPVSKRMWRLDYNAAVTYDFLALEDINGDRIQDILFLYKNTNASDA
VNHSCTEEGSSPCAFVAAVSGANGSVLWERPVAPDVALADCVGPQLTDAKAAPTCVLVGR
PRSFIAVDIFTGKIRWSHPSGFGSNTSILRPLLHVPDINDDGAPDLLLLTREGMEVQGHL
YSGSTGHQIGRGGSLGVDGHSSPLLHVTRTGAHYILLPCANSLCGCSVKGLYKEVTGEEG
SLQTDPLWERKLSSTGHRLHLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXKPVLGHYKPDALAVVIENGTGLDRQILLLDLSSGNTLWSQALPSLPQGPP
STTLPTADHRSAFFFWGLHELTSTNETEPEANWHSLYMFHPTLPHVLLELANVSANIVIA
DVLLFEPSRHAAYILLTGPASSDRPGLVSVTKHKVRDLVPGSRVVRLGEGGPESDQAVRD
RFSQLRYRSDT
Download sequence
Identical sequences ENSOPRP00000004896 ENSOPRP00000004896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]