SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005119 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005119
Domain Number 1 Region: 485-521,634-784
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.28e-32
Family Phosphate binding protein-like 0.00014
Further Details:      
 
Domain Number 2 Region: 13-275
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.22e-18
Family L-arabinose binding protein-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005119   Gene: ENSOPRG00000005570   Transcript: ENSOPRT00000005577
Sequence length 982
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4520:191017:831463:-1 gene:ENSOPRG00000005570 transcript:ENSOPRT00000005577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AIFEENAAKDDRVFQLAVSDLSLNDDILQSEKITYSIKVIEANNPFQAVQEACDLMTQGI
LALVTSTGCASANALQSLTDAMHIPHLFVQRNPGGSPRTACHLNPSPDGEAYTLASRPPV
RLNDVMLRLVTELRWQKFVMFYDSEYDIRGLQSFLDQASRLGLDVSLQKVDKNVSHVFSS
LFTTMKTEELNRYRDTLRRAILLLSPQGAHSFINEAVETNLASKDSHWVFVNEEISDPEI
LDLVHSALGRMTVVRQIFPSAKDNQKCMRKNHRISSLLCDPQEGYLQMLQXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXRADLAISAITITPERESVVDFSKRYMDYSVGILIKKPEEKISIFSLFAPFDFAVWA
CIAAAIPVVGVLIFVLNRIQAVRAQSATQPRPTASATLHSAIWIVYGAFVQQGGESSVNS
MAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSRMDNPIRTFQDLSKQVEMSYGTVRDSAV
YEYFRAKGTNPLEQDSTFAELWRTISKNGGADNCVASPSEGIRKAKKGNYAFLWDVAVVE
YAALTDDDCSVTVIGNSISSKGYGIALQHGSPYRDLFSQRILELQDTGDLDVLKQKWWPH
TGRCDLTSHTSAQADGKSLKLHSFAGVFCILAIGLLLACLVAALELWWNSNRCHQETPKE
DKEVNLEQVHRRMNSLMDEDIAHKQISPASIELSALEMGGLAPSQALEPTREYQNTQLSV
STFLPEQSSHGTSRTLSSGPSSNLPLPLSTSATMPSMQCKHRSPNGGLFRQSPVKTPIPM
SFQPVPGGVLPEALDTSHGTSI
Download sequence
Identical sequences ENSOPRP00000005119 ENSOPRP00000005119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]