SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005370 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005370
Domain Number 1 Region: 1384-1516
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.96e-58
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000262
Further Details:      
 
Domain Number 2 Region: 180-284
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000362
Family Calponin-homology domain, CH-domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005370   Gene: ENSOPRG00000005833   Transcript: ENSOPRT00000005849
Sequence length 1523
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1946:1214:32571:-1 gene:ENSOPRG00000005833 transcript:ENSOPRT00000005849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NIPEDLRDPFYVDQYEQEHIKPPVTKLLLSSELYCRVCGLILTGDQAAALQGHQAVIQAL
SRKGIYVMEGDDTPVTEPDLSRAPIKMSAHMAMVDALMMAYTVEMISIEKVVASVKRFST
FSASQELPYDLEDAMVFWVNKVNLKMREITEKEVKLKQQLLESPAHQKVRYRREPPSARQ
CPYFPWVEDLMRDGSDGAALLAVIHYYCPEQMKLDDICLKEVPSLADSLYNIRLLREFSN
EYLNRCFYLSLEDMVYAPAVLKPNVMVFIAELFWWFESVKPDFVQPRDVQELKGAKTVLS
RKSSRPPVISNTKRSFLGSPAEQPPAALAAEGCHRCHLYPEEAEYPGRGPSAAGPAHPLL
PLRQRQQKTVQGEDSPDQRHRSNSLTRVDGQPRGSAMAWPEKKAXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXQLLLTAPAVPVPEPSQGQKSKGPVYCFEPFWKTAVP
GRRKPARLGQGRSCRAGRPAKLKVPRDRQGSSRSKTPTPSAESLPHLRPFPTNSHSRTPC
DPGSAVDSGGDPPEKSLRDSYRLHDESNQRTLAVPPTKDPNILMEQLGAREAGLGSSDLP
AKEAVPPDEPLRSKASLIEVDLSDLKAPEEDRARGSRAGELPGEGDQKPGVGFFFKDEQK
AEDELAKKRAAFLLKQQRKAEEARVRKQQLEAQVELRRDEARRKAEEDRVRKEEEKARRE
LIKQEYLRRKQQQILEEQGLGKPKTKAKRPRPKSVHREESCSDSGTKCSSTPDNLSRTQS
GSNLSLASAATTEPESVHSGGTPSQRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXPKLFKEPSTKSNKTIIHNAVSHCCLAGKVNEPHKDSVLQELEKCDANHYIILFRD
AGCQFRALYCYYPDTEEVHKLTGTGPKSITKKMIDKLYKYSSDRKQFNLIPAKTMSVSVD
ALTIHSHLWQPRRPAPKKGQSRK
Download sequence
Identical sequences ENSOPRP00000005370 ENSOPRP00000005370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]