SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005462 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005462
Domain Number 1 Region: 45-445
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 5.23e-94
Family Iron-containing alcohol dehydrogenase 0.0000204
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005462   Gene: ENSOPRG00000005949   Transcript: ENSOPRT00000005948
Sequence length 450
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2837:130347:165261:1 gene:ENSOPRG00000005949 transcript:ENSOPRT00000005948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARVAHXXXXXXXXXCQCPVHSHTYSQAPGLSPSGRTTDYAFEMAVSNIRYGAGVTKEV
GMDLQNMGAKNVCLMTDKNLSQLPPVQVVMDSLVKNGIASSFIDAIEFAKKGAFDAYVAV
GGGSTMDTCKAANLYASSPGSDFLDYVNAPIGKGKPVSVPLKPLIAVPTTSGTGSETTGV
AIFDYEHLKVKTGIASRAIKPTLGLVDPLHTRHMPAQVVANSGFDVLCHALESYTAIPYH
MRSPCPSNPSMRPAYQGSNPISDLWSVHALRIVAKYLKRAVRNPDDLEARSNMHLASTFA
GIGFGNAGVHLCHGMSYPISGLVKTYKAKDYNVDHPLVPHGLSVVLTSPAVFTFTAQMFP
ERHLETAEILGADIRTTRTQDAGPVLADALRKFLFDLNVDDGLAALGYSKADIPALVKGT
LPQERVTKLAPRPQSEEDLSALFEASMKLY
Download sequence
Identical sequences ENSOPRP00000005462 ENSOPRP00000005462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]