SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005467 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005467
Domain Number 1 Region: 2-105
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.73e-22
Family YicI N-terminal domain-like 0.0054
Further Details:      
 
Domain Number 2 Region: 208-306,350-376
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.0000116
Family YicI catalytic domain-like 0.056
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000005467
Domain Number - Region: 108-156
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.000295
Family YicI catalytic domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005467   Gene: ENSOPRG00000005947   Transcript: ENSOPRT00000005953
Sequence length 639
Comment pep:novel genescaffold:pika:GeneScaffold_4379:102764:126380:1 gene:ENSOPRG00000005947 transcript:ENSOPRT00000005953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLSISTRLPSQYIYGFGENEHTTFRRNMSWHTWGMFARDEPLAYMKNSYGVHPYYMALE
EDGSAHGVLLLNSNXXXITLQPTPALTYRTTGGILDFYIILGPTPELVTQQYTELIGRPA
MTPYWALGFQLSRYGYQNDTEIANLYDAMVAVQIPYXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXGPAISGNETQYPTFTRGQESNVFIKWPDTSDIVWGKVWPEL
SNVSVNRSLNNEPQVRLSRAHVAFPDFLRNSTATWWKREIKELYTNPGEPEKSLAFDGLR
IDMNEPSNFVDGSVSGCRDEILNNPPYMPYLEARDKGLSNKTLCMESEQILPDGSPVRHY
DVHNLYGWSQTRPTYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXGSGDNSTGEWKILNASLNHINLHVRGGYILPC
QKPAINTQYSRQNFMELIVALDDNGEAKGEMFWDDGQSI
Download sequence
Identical sequences ENSOPRP00000005467 ENSOPRP00000005467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]