SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005523 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005523
Domain Number 1 Region: 115-208
Classification Level Classification E-value
Superfamily Kringle-like 1.04e-35
Family Kringle modules 0.00000629
Further Details:      
 
Domain Number 2 Region: 210-293
Classification Level Classification E-value
Superfamily Kringle-like 3.87e-33
Family Kringle modules 0.0002
Further Details:      
 
Domain Number 3 Region: 302-387
Classification Level Classification E-value
Superfamily Kringle-like 2.15e-31
Family Kringle modules 0.00019
Further Details:      
 
Domain Number 4 Region: 36-125
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 1.29e-21
Family Hairpin loop containing domain 0.00000679
Further Details:      
 
Domain Number 5 Region: 432-476
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000507
Family Kringle modules 0.0022
Further Details:      
 
Domain Number 6 Region: 587-669
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00000000000381
Family Eukaryotic proteases 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005523   Gene: ENSOPRG00000006009   Transcript: ENSOPRT00000006014
Sequence length 670
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_88:87195:155894:-1 gene:ENSOPRG00000006009 transcript:ENSOPRT00000006014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWMSRLVPVLLLQYVLLRLLLLPIAIPYAEGQKKRRNTLHEFKKSAKMTLIKEDPLLKIK
SKKMNSADQCANRCIRNKGLPFTCKAFVFDKTRKRCLWFPFNSMSNGVKKEFGHQFDLYE
NKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEDGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGEGYRGPMDHTETGKICQRWDHQTP
HRHKFLPERYPDKGFDDNYCRNPDGKRRPWCYTLDPDTPWEYCAIKMCAHSVTNETDVPM
ETTECVQGQGEGYRGSANTIWNGIPCQRWDSQYPHQHDITPENFKCKDLRENYCRNPDGA
ESPWCFTTDPNIRVGYCSQIPKCDMSSGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXHIFWEPDASKLTKNYCRNPDDDAHGPWCYTGNPLIPWDYCPLSRCEGDTSPTIVNL
DXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPAILDDFVSTIDLP
NYGCTIPEKTACSVYGWGYTGLINSDDLLRVAHLYIMGNDKCTQQHQGKVTLKESEICAG
AEKIGSGPCE
Download sequence
Identical sequences ENSOPRP00000005523 ENSOPRP00000005523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]