SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005610 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005610
Domain Number 1 Region: 272-416
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 5.23e-41
Family Mannose 6-phosphate receptor domain 0.000000522
Further Details:      
 
Domain Number 2 Region: 119-268
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.27e-39
Family Mannose 6-phosphate receptor domain 0.000000227
Further Details:      
 
Domain Number 3 Region: 576-711
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.14e-37
Family Mannose 6-phosphate receptor domain 0.00049
Further Details:      
 
Domain Number 4 Region: 422-567
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.7e-32
Family Mannose 6-phosphate receptor domain 0.00091
Further Details:      
 
Domain Number 5 Region: 1018-1169
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.28e-31
Family Mannose 6-phosphate receptor domain 0.001
Further Details:      
 
Domain Number 6 Region: 1475-1597
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 6.93e-31
Family Mannose 6-phosphate receptor domain 0.000000369
Further Details:      
 
Domain Number 7 Region: 1937-2076
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.22e-29
Family Mannose 6-phosphate receptor domain 0.0011
Further Details:      
 
Domain Number 8 Region: 1602-1747
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.45e-29
Family Mannose 6-phosphate receptor domain 0.0011
Further Details:      
 
Domain Number 9 Region: 2083-2230
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 8.37e-29
Family Mannose 6-phosphate receptor domain 0.00077
Further Details:      
 
Domain Number 10 Region: 2-116
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.53e-27
Family Mannose 6-phosphate receptor domain 0.00000265
Further Details:      
 
Domain Number 11 Region: 746-876
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.92e-25
Family Mannose 6-phosphate receptor domain 0.0028
Further Details:      
 
Domain Number 12 Region: 1327-1431
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 7.59e-24
Family Mannose 6-phosphate receptor domain 0.0015
Further Details:      
 
Domain Number 13 Region: 887-1028
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 6.28e-23
Family Mannose 6-phosphate receptor domain 0.0034
Further Details:      
 
Domain Number 14 Region: 1173-1289
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.49e-22
Family Mannose 6-phosphate receptor domain 0.00067
Further Details:      
 
Domain Number 15 Region: 1754-1847,1896-1939
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 6.54e-21
Family Mannose 6-phosphate receptor domain 0.0032
Further Details:      
 
Domain Number 16 Region: 1845-1895
Classification Level Classification E-value
Superfamily Kringle-like 6.57e-17
Family Fibronectin type II module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005610   Gene: ENSOPRG00000006084   Transcript: ENSOPRT00000006114
Sequence length 2431
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4217:79988:182881:1 gene:ENSOPRG00000006084 transcript:ENSOPRT00000006114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HTWEAVDTKNNKLYKINLCANMAATPCGPATAVCMHDLRTESYRSVGDFVLRSASRSLLE
FNTTVSCGPPSRGHRVQSSISFRCGKTLGSPEFVTATGCVHYFEWKTTAACKKATFKALK
EVPCYVFDRELRKHDLNPLIRLSGGYLVDDSDPEASLLINVCRDLDSLHDANLQLRACPR
GTAACLVRGDQAFDVGQPKEGLRLLSRDRLVLSYVKEGAEKLDFCDGHSPAVTVTFVCPS
ERREGTIPRLTAKSNCRYEVEWVTEYACYRDYLESRSCSLSSRQHDVTVDLSPLGQPTGL
PYTSDGGEYLFYLNICGGAGMTNCRDRDAAVCQVKKADSTQRKVSGRGQNQTLRYSDGDL
TLIYFGGDECSSGFQRMSVITFECNQTADNDGKGAPVYTGEIDCTYFFVWDTKYACIKEK
EGLPCGAIDGKKRYDLSALVRHSESERNWEAVDGSQKGGEKKHFFINICHRVLQEGQARG
CDEEAAVCAVDKSGKKSLGKFISPPTKEKGSILLSYSDGDDCGDNRQITTNITLVCKPGD
LESAPLLTSSGDDDCFYEFEWHTAAACVLSRTEGENCTVFDSQAGFSFNLLPLMKKNGAY
KVEAGKYDFYINVCGPVIGTPCTSDAGACQVVKSTGKTWDLGVSSNKLSYYDGMIQLSYR
DGTPYNNARRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTRYACPEEPLECVVT
DPXXXXXXXXXXLAKAEGNSAGGGGNWYALDNSGERGTWKKYYINVCRPLNPVLGCDRYA
AACQMQYQKTPESYTESVSISNLGVAKTGPIVEETGSLLLEYVNGSACTTSDGEQTNYTT
RIHLVCSRGNLNTHPIFSLNWECVVSFLWNTEAACPVQVMTATDQVCSIRDPNSGFVFNL
SPLNSSQGYVIPAIGKTFMFNVCGTMPICGTVGDTPASGCEAETQTEDLTNLKPEWPVGS
EKSLQLSTEGFLTLVYKGPSSTRGTSFIIRFVCNDDVYPGAPKFLHQDIDSRRGVRNTYF
EFETALACVPSPVDCQVTDPAGNEYDLSALSAVRKPWTAVDVSGSGKKRTFYLSVCNPLP
YIPGCHGTALGSCLVSEENNLNLGVVQISPQAVENGSLSIVYVNGDKCGNQRYSTRITFE
CAQVTGSPTFQLQDGCEYVFVWRTVEACPVVRVEGDNCEVRDPRHGNLYDLKPLGLNDTM
VSTSEYNYYFRVCGKLSLDVCPISDKSKTVSSCQEKKGPGGFQKVAGLLTQKLTYENGLL
RMNYTGGDTCHKVYQRSTTIFFYCDRSTQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXDDTGEPYDLSSLSRYSDNWEAITRTGSSDHYIINVCKSLAPQPGTDPCPPEAAACLV
GGPRPVNLGRVKDSPQWKDGVTILQYVDGDLCPDGIRKKSTTIRFTCNENQMXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHLFDLTSLSGRTGFTAAYSERGLVY
MSICGENENCSPGVGACFGQTRISVGKASKRLSYVDQVLQLVYEDGSPCPSKNGLTYKSV
ISFVCRPETGPTNRPMLVSLDKQTCTLFFSWHTPLACEQVTECSVRNGSSIIDLSPLIHR
TGGYEAYDESEEETSDTYPDFYINICQPLNPMHGVACPAGAAVCKVPVDGSPLDIGRVTG
PPVLNSAANEVYMNFASKTPCLKDKRLNYTSLITFHCRRGVSMGTPKLIRTSDCDFVFEW
ETPIVCPDEVRADGCSLTDEQLLYSFNLSSLSKEIFKVTRDSRTYSVGVCTAAAGPDEGG
CKDGGVCLLSGTKGASFGRLASMRLDYRHQDEAVILTYVNGDLCPPETDDGDLCVFPFTF
NGKSYEECIVEGRAKLWCSTTANYDRDHEWGFCRQSTSHRTSAIIFRCDEDEDIGRPQVI
SEVRGCEVTFEWKTKVVCPPEKMECKFVQNHKTYDLRLLSSLTGSWFLTYEGATYFINLC
QRVYKGPFECSERASICKKTSTGQVQSLGLVHTQKLDVMDDKVIVTYSKGHPCGENQTAS
SVIELGCAKTVGKPVFMRFDTDSCTYYFSWDSRAACAVKPQEVQMENGTLINPVNGKSVS
LGDMYFKLFSASGDVRPNGDTYLYEIQLSSLSSPTHPGCSGASVCQVKPNDQRFSRKVGT
SENTRYYVQDGDLDIVFTSSSKCGKDKSKSVSSTIFFHCDPLVQDGIPEFSHETADCQYL
FSWYTSAVCPLGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXVNKEEETEEHESEWLMEEIQPGAARPGKDSQENG
HVTTKPVQAEALTVLRGDDQDSEDEVLTIPDVTCNVRAGPERCQPRHPQCKAPGKGDDKL
GLCGDRARRGRLGGPPHSAAHDDSDEDLLHI
Download sequence
Identical sequences ENSOPRP00000005610 ENSOPRP00000005610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]