SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005793 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005793
Domain Number 1 Region: 167-424
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.31e-78
Family Eukaryotic proteases 0.0000000126
Further Details:      
 
Domain Number 2 Region: 50-106
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000725
Family Kringle modules 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005793   Gene: ENSOPRG00000006318   Transcript: ENSOPRT00000006316
Sequence length 432
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3173:194874:199853:1 gene:ENSOPRG00000006318 transcript:ENSOPRT00000006316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLLVCLLSCTLVVSDSEGSNELHRVSDASHCSCLNGGKCVSYKYFSNIWRCDCPKNFQ
GEHCEIDKSTTCYHGNGHYYRGKANTDIMGRRCLDWNSHAVLKTYHXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKRPTPPPRKLEFQCGQKALRPRFKI
VGGEFTTIENQPWFAAIYRKHRGSNDTYLCGGSLISPCWVVSATHCFINNPKKENYVVYL
GRSRINSMTPGEMKFEVKQLILHEGYSADSLAHHHDIALLKILSSTGHCAEPSRSIQTIC
LPPSHGDVNFGSNCEIAGFGKENSIDYMFPERLKMAVVKLLSYEECQQPHYYGSEVTNKM
LCAADPNWETDSCQGDSGGPLVCSKEGRMTLTGIVSWGSGCAVKYKPGVYTRVAEFLPWI
YRHIGEENGLIP
Download sequence
Identical sequences ENSOPRP00000005793 ENSOPRP00000005793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]