SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005836 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005836
Domain Number 1 Region: 481-533,567-733
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.86e-58
Family YicI catalytic domain-like 0.0014
Further Details:      
 
Domain Number 2 Region: 1473-1629
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.21e-45
Family YicI catalytic domain-like 0.0019
Further Details:      
 
Domain Number 3 Region: 979-1193
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.65e-33
Family YicI N-terminal domain-like 0.017
Further Details:      
 
Domain Number 4 Region: 1632-1712
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 3.38e-20
Family Putative glucosidase YicI, domain 3 0.01
Further Details:      
 
Domain Number 5 Region: 736-816
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.59e-16
Family Putative glucosidase YicI, domain 3 0.025
Further Details:      
 
Domain Number 6 Region: 214-293
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.00000000000000257
Family YicI N-terminal domain-like 0.02
Further Details:      
 
Domain Number 7 Region: 947-1000
Classification Level Classification E-value
Superfamily Trefoil 0.0000000000144
Family Trefoil 0.0026
Further Details:      
 
Domain Number 8 Region: 113-143
Classification Level Classification E-value
Superfamily Trefoil 0.00000562
Family Trefoil 0.0058
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000005836
Domain Number - Region: 330-356
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.00232
Family YicI N-terminal domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005836   Gene: ENSOPRG00000006341   Transcript: ENSOPRT00000006367
Sequence length 1774
Comment pep:novel genescaffold:pika:GeneScaffold_5477:29249:109461:1 gene:ENSOPRG00000006341 transcript:ENSOPRT00000006367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRKVKKFTTLELVLSTILLVVFIIAAVLIVLLATGPAESKXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLVFEQRGCCWN
SKRERRVAWCYYSKNHGYQVESDLVNTNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLNYEVEVSKQPFSIKVTRRSNNRVLFDS
SIGPLLFADQFLQLSIRLPSANVYGLGEHVHQQYRHDMNWKTWPIFTRDTAPNEXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXVALQPAPAVTYRTIGGILDFYVFLGDTPEQVV
QEYLELIGRPALPAYWALGFHLSRYDYGSLENMRRVVERNRAAQLPYXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPAISNNSPSDNPYGPYDRGSAMRIWVND
STGVTPIIGQVWPGTTVFPDYTNPSCAVWWANEFELFYNQVKFDGIWIDMNEVANFVAGS
VSGCSTNNLNYPFVPSILDGRLFSMTLCMDAVQHWGKQYDVHSLYGYSMTIATAEAVKTV
FPNKRSFVVTRSTFAGSGKFAGHWLGDNTASWNDLRWSIPGVLEFNLFGIPMVGPDICGY
YQNTSEELCRRWMQLGAFYPFSRNHNGQGYQEQDPAFFGADSLLLNSSRHYLNIRYTLLP
YLYTLFYRAHSRGDTVARPLLHEFYGDNNTWDVYQQFLWGPGLLITPVLEEGAENVVAYV
PDAVWYDYETGAQMSWRKERVVMELPGDKIGLHLRGGYIFPTQQPDTTTTASRLNALGLI
IALDENKEAKGELFWDDGDTQDTVANNAYLLCEFSVTQNRLDVTILQSGYRDPNNLSFKE
IKILGTQNINSVTVRHNGVLTQSSPNVTYDYDLKVAVITDIDLVLGEAYTVEWSLFTRNE
EKIDCYPDEHDVTAENCIARGCVWEESSIPGVPYCYFVDDLYSVSNIQYNSNGASADITL
KASLYTNAFPSTPVNPLRLQVTYHKNEMLQFKIYDPNNSRYEVPVPLNLPAAPSSTPENQ
LYEVVIKENPFGVVIQRKSTGTIIWDSQVLGFTFNDMFIRISTRLPSTYLYGFGETEHTS
FRRDLNWHTWGMFARDQPPGYKLNSYGVHPYYMALEEDGSAHGVLLLNSNAMXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXLEARGTGLNSKTLCMESEQILPDGSPVRHYDVHNLYGWSQTRPTYEAVQEVT
GQRGIVITRSTFPSSGRWGGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFFQ
DSEYEMCARWMQLGAFYPFSRNHNTLGAKRQDPVSWNATFEDISRSVLKTRYTLLPYFYT
LMYKAHVDGSTVVRPLLHEFVSDQVTWDIDGQFLLGPAFLISPVLQPGAREVTAYFPEAR
WYDYHTGAEVNAKGQWKVLAAPLDHINLHVRGGYILPWQEPALNTHQSRLNALGLIIALD
ENKEAKGELFWDDGDTKDTVASNVYLLCEFSASQ
Download sequence
Identical sequences ENSOPRP00000005836 ENSOPRP00000005836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]