SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005945 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005945
Domain Number 1 Region: 212-314
Classification Level Classification E-value
Superfamily SRCR-like 1.06e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000514
Further Details:      
 
Domain Number 2 Region: 319-420
Classification Level Classification E-value
Superfamily SRCR-like 2.88e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00015
Further Details:      
 
Domain Number 3 Region: 705-803
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.06e-33
Family Eukaryotic proteases 0.0064
Further Details:      
 
Domain Number 4 Region: 445-528
Classification Level Classification E-value
Superfamily SRCR-like 2.35e-26
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00022
Further Details:      
 
Domain Number 5 Region: 99-151
Classification Level Classification E-value
Superfamily SRCR-like 8.11e-16
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0056
Further Details:      
 
Domain Number 6 Region: 32-103
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000314
Family Kringle modules 0.0088
Further Details:      
 
Domain Number 7 Region: 587-610
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.000000427
Family Eukaryotic proteases 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005945   Gene: ENSOPRG00000006485   Transcript: ENSOPRT00000006487
Sequence length 804
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3550:5442:105030:-1 gene:ENSOPRG00000006485 transcript:ENSOPRT00000006487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRALPARRLHAPQAGHTPRPRPGGCPADQPWINVTDFGAPCLLWAEVPPFLERSPPTGWA
QVRGQRHNFCRSLDSAGSPWCFYRDAHGKVDWGYCDCRHGSVRLHGGRNEFEGTVEVYAG
GMWGAICSSHWDDSDASVICHQLQLGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXAVLPVIRLVGGSSVHEGRVELYHAGQWGTVCDDQ
WDDADAEVVCRQLGLSGIAKAWNKAYFGEGSGPIMLDEVRCTGNELSIEQCPKSSWGEHN
CGHKEDAGVSCTPLTDGVIRLAGGKSNQEGRLEVYYRAQWGTVCDDGWSELNTYVVCRQL
GFKYGKQVSANHLEESAGPIWLDDVSCSGKESSLLQCSRRQWGRHDCSHREDVAIACYPG
SDGHRLALXXXXXXXXXXXXXXXXVEVFIGWETICDDWTDKDATVICRQLGYKGPARART
MAYFGEGKGPIHVDNVKCTGNERSLADCIKQDIGKHNCRHSEDAGVICDYFSKKASSNSN
IXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCGATLLSSCWV
LTAAHCFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRAYSRTLQQAAIPLLPK
RFCEERYKGRFTGRMLCAGNLQEQQRVDSCQGDSGGPLMCERPGQSWVVYGVTSWGHGCG
AKDSPGVYTKVSAFVPWIKSVTQL
Download sequence
Identical sequences ENSOPRP00000005945 ENSOPRP00000005945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]