SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005966 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005966
Domain Number 1 Region: 60-133
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000238
Family HLH, helix-loop-helix DNA-binding domain 0.000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005966   Gene: ENSOPRG00000006521   Transcript: ENSOPRT00000006514
Sequence length 221
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4928:208949:233019:1 gene:ENSOPRG00000006521 transcript:ENSOPRT00000006514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVRMNIQMLLEAADYLERRERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXST
HNEMEKNRRAHLRLCLEKLKGLVPLGPESNRHTTLSLLTKAKLHIKKLEDCDRKAVHQID
QLQREQRHLKRQLEKLGIERIRMDSIGSTVSSERSDSDREEIDVDVESTDYLTGDLDWSS
SSVSDSDERGSMQSLGSDEGYSSSSVKRIKLQDSRDVCLGL
Download sequence
Identical sequences ENSOPRP00000005966 ENSOPRP00000005966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]