SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006007 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006007
Domain Number 1 Region: 95-153
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.7e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006007   Gene: ENSOPRG00000006565   Transcript: ENSOPRT00000006559
Sequence length 337
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1030:468604:469617:-1 gene:ENSOPRG00000006565 transcript:ENSOPRT00000006559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTLPFDESVVMPESQMCRKFSRECEDQKQIKRPDSFSKQIVLRGKSIKRAPGEETEKEE
EEEDREEEDENGLPRRRGLRKKKTTKLRLERVKFRRQEANARERNRMHGLNDALDNLRKV
VPCYSKTQKLSKIETLRLAKNYIWALSEILRIGKRPDLLTFVQNLCKGLSQPTTNLVAGC
LQLNARSFLMGQGGEAAHHTRSPYSTFYPPYHSPELTTPPGHGTLENSKSMKPYNYCSAY
ESFYESTSPECASPQFEGPLSPPPINYNGIFSLKQEETLDYGKNYNYGMHYCAVPPRGPL
GQGAMFRLPTDSHFPYDLHLRGQSLAMQDELNAVFHN
Download sequence
Identical sequences ENSOPRP00000006007 ENSOPRP00000006007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]