SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006029 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOPRP00000006029
Domain Number - Region: 271-329
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0471
Family Quinoprotein alcohol dehydrogenase-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006029   Gene: ENSOPRG00000006572   Transcript: ENSOPRT00000006583
Sequence length 1390
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4976:202162:257008:-1 gene:ENSOPRG00000006572 transcript:ENSOPRT00000006583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSSLLGPVVQASASAAALQEALENAGRLIDRQLQEDRMYPDLSELLMVSAPNNPTVSGM
SDMDYPLQGPGLLSVPNLPEISSIRRVPLPPELVEQFGHMQCNCMMGVFPAVSRAWLTID
SDIFMWNYEDGGDLAYFDGLSETILAVGLVKPKAGVFQPHVRHLLVLATPVDIVILGLSY
ANLQAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXSFLVPSLLQFTFSEDDPIVQIAIDNSRNILYTRSEKGVI
QVYDLGHDGQGMSRVASVSQNAIVSAAGNIAXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXVRLYFSTCPFRQPLARPNTLTLVHVRLPPGFSASSTVEKPSKVHKALYSKXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTTRVDGHSWALSAIDELKVDKIITPLNKDH
IPITDSPVVVQQHMLPPKKFVLLSAQGSLMFHKLRPVDQLRHLLVSNVGGDGEEIERFFK
LHQEDQACATCLILACSTAACDREVSAWATRAFFXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIESSVPCQLLESVLQELKGLQEF
LDRNSQFAGGPLGNPNTTAKVQQRLMGFMRPENGNSQQMQQELQRKFHEAQLSEKISLQA
IQQLVRKSYQALALWKLLCEHQFTLIVGELQKEFQEQLKITTFKDLVIRDKELTXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXANELLQRSRQVQNKTEKERMLRES
LKEYQKISSQVDLSSVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDIV
GLQAFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHHF
EQMLKLAQRSKDELFSIALYNWLIQADLADKLLQIASPFLEPHLARMAKVDQNKVCYMDL
LWRYYEKNRSFSSAARVLSKLADMHSTEISLQQRLEYIARAILSAKSSTAISSIAADGEF
LHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAVSQLDSELMDITKLYAEFADPFKAEC
KLAIIHCAGYSDPILVQTLWQDIVEKELNDSVMLSSSDRMHALSLKIVLLGKIYAGTPRF
FPLDFIVQFLEQQVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRMKKPL
HLLDCIHVLLTRYVENPSHVLNCERRRFTNLCLDAVCGYLVELQSMSSSTAVQAITGNFK
SLQAKLERLH
Download sequence
Identical sequences ENSOPRP00000006029 ENSOPRP00000006029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]