SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006133 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006133
Domain Number 1 Region: 145-272
Classification Level Classification E-value
Superfamily FKBP-like 8.05e-38
Family FKBP immunophilin/proline isomerase 0.00034
Further Details:      
 
Domain Number 2 Region: 262-382
Classification Level Classification E-value
Superfamily FKBP-like 3.54e-37
Family FKBP immunophilin/proline isomerase 0.00028
Further Details:      
 
Domain Number 3 Region: 39-151
Classification Level Classification E-value
Superfamily FKBP-like 3.73e-37
Family FKBP immunophilin/proline isomerase 0.00016
Further Details:      
 
Domain Number 4 Region: 374-483
Classification Level Classification E-value
Superfamily FKBP-like 3.54e-31
Family FKBP immunophilin/proline isomerase 0.00051
Further Details:      
 
Domain Number 5 Region: 492-568
Classification Level Classification E-value
Superfamily EF-hand 0.000000194
Family Calmodulin-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006133   Gene: ENSOPRG00000006701   Transcript: ENSOPRT00000006697
Sequence length 581
Comment pep:known_by_projection scaffold:pika:scaffold_18208:469:5326:1 gene:ENSOPRG00000006701 transcript:ENSOPRT00000006697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTEEPPSSTLRRLPLLLLLLQAVGRGLSHASPAGAPLEDVVIERYHIPRACPREVQMGD
FVRYHYNGTFEDGKKFDSSYDRNTLVAIVVGVGRLITGMDRGLMGMCVNERRRLIVPPHL
GYGSIGVAGLIPPDATLYFDVVLLDVWNKADTVQVSILLRPPHCPRMVRDSDFVRYHYNG
TLLDGTAFDNSYSRGGTYDTYIGSGWLIKGMDQGLLGMCPGERREIIIPPFLVYGEKGYG
TVIPPQASLVFHVLLVDVHNPKDSVQTETLELPPGCTRRAMVGDFMRYHYNGSLMDGTLF
DSSYSRNQTYNTYIGQGYIIPGMDQGLQGACIGERRRVTIPPHLAYGENGTGDKIPGSAV
LIFDVHIIDFHNPADPVEIQTLSRPPEACNETEAAKLGDFVRYHYNCSLLDGTHLFSSHD
HGAPQEATLGANKVIEGLDRGLQGMCVGERRQLVIPPHLAHGESGARGVPGSAVLRFEVE
LVSREDGLPTGYLFVWHEDPPANLFENMDLNKDGEVPLEEXXXXXXXXXXXXXXXXXXXQ
DPEKTIGDMFQNQDRNQDGKVTTDELKLKSDEDQERVHEEL
Download sequence
Identical sequences ENSOPRP00000006133 ENSOPRP00000006133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]