SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006263 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006263
Domain Number 1 Region: 311-394
Classification Level Classification E-value
Superfamily Kringle-like 8.7e-34
Family Kringle modules 0.00034
Further Details:      
 
Domain Number 2 Region: 652-757
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.63e-26
Family Protein kinases, catalytic subunit 0.0000341
Further Details:      
 
Domain Number 3 Region: 62-154
Classification Level Classification E-value
Superfamily Immunoglobulin 1.16e-21
Family I set domains 0.032
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000006263
Domain Number - Region: 170-257
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00314
Family Frizzled cysteine-rich domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006263   Gene: ENSOPRG00000006840   Transcript: ENSOPRT00000006836
Sequence length 937
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_487:161782:575435:1 gene:ENSOPRG00000006840 transcript:ENSOPRT00000006836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRPRRRGTRPPLLALLAALLLAARGAAAQXXXXXXXXXXXXXXXXXXXXXXXXXSYLTL
DEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRATNYGSRLRIRN
LDTTDTGYFQCVATNGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYRGIACAR
FIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSA
VPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIG
IPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHMHTFTALRFPELNGGHS
YCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKMEILYILVPSVTIPLAIAL
LFFFICVCRNNQKSSSPPVQRQPKHVRGQNVEMSMLNAYKPKXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIRWMP
PEAIMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLLPCSEDCPPR
MYSLMTECWNEIPSRRPRFKEIHVRLRSWEGLSSHTSSTTPSGGNATTQTTSLSASPVSN
LSNPRYPNYMFPSQGITPQGQIAGFIGPPIPQNQRFIPINGYPIPPGYAAFPAAHYQPPG
PPRVIQHCPPPKSRSPSSASGSTSTGHVTSLPSSGSNQEANIPLLPHMSMPNHPGGMGIT
VFGNKSQKPYKIDSKQPSLLGDSNIHGHTESMISAEL
Download sequence
Identical sequences ENSOPRP00000006263 ENSOPRP00000006263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]