SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006375 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006375
Domain Number 1 Region: 22-355
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.09e-113
Family Transferrin 0.000000256
Further Details:      
 
Domain Number 2 Region: 509-705
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.77e-66
Family Transferrin 0.00000391
Further Details:      
 
Domain Number 3 Region: 364-444
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.92e-19
Family Transferrin 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006375   Gene: ENSOPRG00000006962   Transcript: ENSOPRT00000006961
Sequence length 739
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1516:165261:183338:-1 gene:ENSOPRG00000006962 transcript:ENSOPRT00000006961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGPSPALWLFLALRTALGGVEVRWCTVSEPEQQKCSDMSQAFQHADLQPALLCVQGTSA
EHCVQLIAAQEADAITLDGGAIYEAGKEYHLKPVVGEVYDQEVGTSYYAVAVVRKSFNVT
INTLRGVKSCHTGINRTVGWNVPVGFLVDSGRLSVMGCNVLRAVSEYFGGSCVPGARETS
YSESLCRLCRGDSSGEGMCDKSPLERYYDYSGAFRCLAEGAGDVAFVKHSTVLENTDGRT
LPSWGRPLMSRDFQLLCRDGSRADVTEWRRCHLARVPAHAVVVRADMDGGLIFRLLNEGQ
RLFSHEDSSFQMFSSEAYGHRNLLFKDSTTELVPIATQTYEAWLGHEYLHAMKGLLCDPN
RLPPYLRWCVLSTPEIQKCGDMAVAFSRQRLKPEIQCVSAESPQHCMEQIQAGHIDAVTL
KGEDIHTAGRTYGLIPAAGELYAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXVGQFFNASCVPVNNAKEYPSSLCALCVGDEL
GRHKCIGNSQERYYGDSGAFRCLAEGAGDVAFVKHTTVFDNTNGHNSEPWAAHLRTQDYE
LLCPNGARAEVHQFEACNLARIPSHAIMVRPDTNIFTVYGLLDKAQDLFGDDGNNNGFRM
FDSSNYHGQDLLFKDDTVQVVPVGQKTTYRDWLGPDYVAALEGMLSQQCSGAAANAPRAL
LLLLLSLLALANGLLLLSV
Download sequence
Identical sequences ENSOPRP00000006375 ENSOPRP00000006375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]