SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006385 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006385
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Pre-PUA domain 7.19e-43
Family Nip7p homolog, N-terminal domain 0.00000196
Further Details:      
 
Domain Number 2 Region: 95-170
Classification Level Classification E-value
Superfamily PUA domain-like 1.05e-26
Family PUA domain 0.0000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006385   Gene: ENSOPRG00000006981   Transcript: ENSOPRT00000006971
Sequence length 180
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_879:372805:374754:1 gene:ENSOPRG00000006981 transcript:ENSOPRT00000006971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLTEEETRVMFEKMAKYVGENLQLLVDRPDGTYCFRLHNDRVYYVSEKILKLAANISG
DKLVSLGTCFGKFTKTHKFRLHITALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGR
ITENTAQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADVGEYVRHEETLT
Download sequence
Identical sequences ENSOPRP00000006385 XP_004584038.1.84141 ENSOPRP00000006385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]