SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006445 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006445
Domain Number 1 Region: 23-285
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.83e-32
Family L-arabinose binding protein-like 0.0077
Further Details:      
 
Domain Number 2 Region: 648-794
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.26e-29
Family Phosphate binding protein-like 0.000000141
Further Details:      
 
Domain Number 3 Region: 414-491
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.6e-16
Family Phosphate binding protein-like 0.00000628
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000006445
Domain Number - Region: 591-647
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00863
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006445   Gene: ENSOPRG00000007037   Transcript: ENSOPRT00000007037
Sequence length 802
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1552:471:96035:1 gene:ENSOPRG00000007037 transcript:ENSOPRT00000007037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKIMHISALLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTP
HIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDG
THPFVIQMRPDMKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINV
GNINNDKKDETYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANL
GFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTTTIKXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTT
ILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKI
WNGMVGELVYGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTEEFEDGRETQSSESTNEFGIFNSLWF
SLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL
SKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGK
YAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRTPVNLAVLKLSEQGVL
DKLKNKWWYDKGECGAKDSGSK
Download sequence
Identical sequences ENSOPRP00000006445 ENSOPRP00000006445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]