SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006745 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006745
Domain Number 1 Region: 8-139
Classification Level Classification E-value
Superfamily PHP domain-like 3.77e-34
Family RNase P subunit p30 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006745   Gene: ENSOPRG00000007367   Transcript: ENSOPRT00000007362
Sequence length 142
Comment pep:known_by_projection scaffold:pika:scaffold_17933:2960:17644:1 gene:ENSOPRG00000007367 transcript:ENSOPRT00000007362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RATSSRVRLYDIVAVFPKTEKLFHVACTHLDVDLVCITVTEKLPFYFKRPPINVAIDRGL
GFELVYGPAIKDSTIRRYTISNALNLMQICKGKNVIISSAAERPLEIRGPYDIANLGLLF
GLSESDGKAAVSTNCRAVLLHG
Download sequence
Identical sequences ENSOPRP00000006745 ENSOPRP00000006745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]