SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006852 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006852
Domain Number 1 Region: 314-418,540-611
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.85e-21
Family Phosphate binding protein-like 0.00000142
Further Details:      
 
Domain Number 2 Region: 4-232
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.00000000000000198
Family L-arabinose binding protein-like 0.012
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000006852
Domain Number - Region: 481-513
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0714
Family Voltage-gated potassium channels 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006852   Gene: ENSOPRG00000007478   Transcript: ENSOPRT00000007482
Sequence length 1324
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4525:394196:567637:-1 gene:ENSOPRG00000007478 transcript:ENSOPRT00000007482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPSSTFFQFGASIQQQATVMLKIMQDYDWHVFSLVTTIFPGYRDFISFIKTTVDNSFVGW
DMQNVITLDTSFEDAKTQVQLKKIHSSVILLYCSKDEAVLILSEARSLGLTGYDFFWIVP
SLVSGNTELIPKEFPSGLISVSYDDWDYSLEARVRDGLGILTTAASSMLEKFSYIPEAKA
SCYGQTEKPETPLHTLHQFMVNVTWDGKDLSFTEEGYQVHPRLVVIVLNKDREWEKXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXNSTNEGMNVKKCCKGFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVNNVWNGMIG
EPPHRRAARAGGLNTKEEGFGVVSPSPRPGEERLIVFVKSSTPPLFFFLEPFSASVWVMM
FVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFTIGKAIWLLWGLVFNNSVPVQN
PKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFR
FGTVPNGSTERNIRNNYPYMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGR
DEGCKLVTIGSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEMEELEALWLTGICH
NEKNEVMSSQLDVDNMAGVFYMLAAAMALSLITFIWEHLFYWKLRFCFTGVCSDRPGLLF
SISRGIYSCIHGVHIEEKKKSPDFNLTGSQSNMLKLLRSAKNISNMSNMNSSSRMDSPKR
TADFIQRGSLIMDMVSDKGNLIYSDNRSFQGKDSIFGENMNELQTFVANRHKDSLNNYVF
QGQHPLTLNESNPNTVEVAVSTESKANSRPRQLWKKSMESLRQDSLPQNPVSQREEGPAE
NRTHSLKSPRYLPEEMAHSDISEASSRATCHRDPDNNKNHKTKDNFKRSAASKYPKDCSE
VERPYLKTKASSPRDKIYTIDGEKEPSFHLDPPQFVENTALPENMDFPDPYQDHSNSFRK
ADTTLPVNRNRLHNEDGLPNNDQHKLYPKHFTLRDKGSPHSEGSDRYRQNSTHCRSCLSN
LPTYSGHFTMRSPFKCDACLRMGNLYDIDEDQMLQETGNPATQEEAYQQDWAQNNALQLQ
KNKLRISRQHSYDNILDKPRELDLSKPSRSISLKDRERLLEGNLYGSLFSVPSSKLLGNK
SSLFPQGLEDSKRSKSLLPDHTSDNPFLHSYGDDQRLVIGRCPSDPYKHSLPSQAVNDSY
LRSSLRSTASYCSRDSRSHSDVYISEHVMPYVANKNNMYSTPRVLNSCSNRRVYKKMPSI
ESDV
Download sequence
Identical sequences ENSOPRP00000006852 ENSOPRP00000006852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]