SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007068 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007068
Domain Number 1 Region: 91-164
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000497
Family HLH, helix-loop-helix DNA-binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007068   Gene: ENSOPRG00000007722   Transcript: ENSOPRT00000007717
Sequence length 258
Comment pep:known_by_projection scaffold:pika:scaffold_3604:124538:125347:1 gene:ENSOPRG00000007722 transcript:ENSOPRT00000007717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYYAVSQKRVNAAAPATMLRPQRPGDAQLGTSLYELVGYRQPPSSSSTTSSSPSTMGSLL
PKAAREKPEAQNEPGTGAHPASPDSKEEQQQQLRRKINSRERKRMQDLNLAMDALREVIL
PYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRALGEGAGPAAPRLLLAGLPL
LAAAPGSVLLAPGAVGPPDALRPAKYLSLALDEPPCSQFALPSGGAGGPGLCTCAVCKFP
HLVPAGLNLATVQAQFSK
Download sequence
Identical sequences ENSOPRP00000007068 ENSOPRP00000007068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]