SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007075 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007075
Domain Number 1 Region: 4-130
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 3.66e-31
Family TRAPP components 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007075   Gene: ENSOPRG00000007729   Transcript: ENSOPRT00000007725
Sequence length 131
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_783:183615:194864:-1 gene:ENSOPRG00000007729 transcript:ENSOPRT00000007725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKGRWITKLENMGFRVGQGLIERFTKDTARFKDELDIMKFVCKDFWTTVFKKQIDNLRTN
HQXXXXXXXXXXXXXXXXXXXXXXXXXXXXYLAFTCGLIRGGLSNLGIKSIVTAEVSSMP
ACKFQVMIQKL
Download sequence
Identical sequences ENSOPRP00000007075 ENSOPRP00000007075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]