SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007082 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007082
Domain Number 1 Region: 343-408
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.01e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007082   Gene: ENSOPRG00000007735   Transcript: ENSOPRT00000007734
Sequence length 429
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_840:11744:42377:-1 gene:ENSOPRG00000007735 transcript:ENSOPRT00000007734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHAAEPARDGVEASAEGPRAVFVLLEERRPADSAQLLXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXLPISLQATPATPATLSASSSAGGSRTPAMSSASSSRVLLRQQL
MRAQAQEQERRERREQAAAAPFPSPAPASPAISVVGVSAGGHTLGRPPPAQVPREVLKVQ
THLENPTRYHLQQARRQQVKQYLSTTLGPKLASQALTPPPGPATAQPLPAPEAAHATSGP
TGSAPNSPMALLTIESSSEKEIDDVIDEIISLESSYNDEMLSYLPGGTAGLQLPSTLPVS
GNLLDVYSSQGVATPAITVSNSCPAELPNIKREISETEAKALLKERQKKDNHNLIERRRR
FNINDRIKELGTLIPKSSDPEMRWNKGTILKASVDYIRKLQKEQQRSKDLESRQRSLEQA
NRSLQLRIQ
Download sequence
Identical sequences ENSOPRP00000007082 ENSOPRP00000007082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]