SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007103 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007103
Domain Number 1 Region: 96-203
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.57e-16
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.032
Further Details:      
 
Domain Number 2 Region: 242-293
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000445
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00046
Further Details:      
 
Domain Number 3 Region: 15-71
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000887
Family HLH, helix-loop-helix DNA-binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007103   Gene: ENSOPRG00000007753   Transcript: ENSOPRT00000007760
Sequence length 818
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_104:286132:326094:1 gene:ENSOPRG00000007753 transcript:ENSOPRT00000007760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKNADGADKKNRISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVM
RLTISYLRVRKLLDAGDLDVEDEMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYM
GLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGPVKKGKEQNTQRSFFLRMKCTLTSRGR
TMNIKSATWKVLHCTGHIHVYDTNSNQSQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSK
TFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGIIQHDLIFSLQQTECV
LKPVESSDMKMTQLFTKVESADASCLFDKLKKEPDALTLLAPAAGDTIISLDFGSSDTET
EQQEEVPLYNDVMFPSSNEKVQNINLAMSPLPASESPKPLRSSADPVLNEEIVLKLEPNP
ESLELSFTMPQIQDQPASPSDGSTRQSSPEPTSPSEYCFDVDSDMVNVFKLELVEKLFAE
DTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSTSPQAVSAVTAFQQT
PMQEPSTNTATAKEVKTETKDSLEDIKVLIACPSPTHIPKETASATTSAPYSGTQSRTAS
PNTAGKGVIEQTEKSHPRSPNLLSVTLSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLACRLLGQSMD
ESGLPQLTSYDCEVNAPVQGSRNLLQGEELLRALDQVN
Download sequence
Identical sequences ENSOPRP00000007103 ENSOPRP00000007103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]