SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007138 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007138
Domain Number 1 Region: 203-302,345-497,557-597
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4e-24
Family Quinoprotein alcohol dehydrogenase-like 0.035
Further Details:      
 
Domain Number 2 Region: 874-981
Classification Level Classification E-value
Superfamily ARM repeat 0.00000612
Family PBS lyase HEAT-like repeat 0.066
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000007138
Domain Number - Region: 580-634
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0177
Family All0351-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007138   Gene: ENSOPRG00000007802   Transcript: ENSOPRT00000007797
Sequence length 1340
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4062:44980:51616:-1 gene:ENSOPRG00000007802 transcript:ENSOPRT00000007797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPRLIPLWKDFKSLVNDTIQKGKKPSADPKNDLVVLSDRSQAVVWMKSKTEDMVEKRT
FSMTERLPPIQTMVHTGSFHILVAYCGDLFLRLFGDHFRAFXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXGSSITCCCTCFDQGLLYAGHKAGEIQVWNLNWGQSLHSF
RAHSLSVICIHSRPEAHTLLTAGKEGLIKEWNLTSGNLLRRLELGEELHRLQFIDNTTFF
CQTNHSFSLRCLPCFYSLFNVCGSTPQQVRRVRCGENWYRILCTTEDGLLHFVSPITGNL
LVLTWPFSILDQAVDWAYDPGKEELFVATGSSEVLVFDTTRCPCPAKYLLCTSSDSKDFV
QCLAYGHFHLGRGLEGLMFSGHQSGVIRVLSQHSCARIEKFMHFGAVLSLSTMSGGILGG
RENSLLCSYGMDDYVHLSETVLDGIRVHLRPLASILSSCHLKHLILLPKSVGAITETNCL
CLWRFYDFLSSGSQGSFKFIETLPLHQCSIMSFDVCLPLSVFVTGGTDGSVRIWDFHGRL
IAMLDSSLHFGPICFANDRGDLLVTFNQSLYLVSCLKLFPPNILSCFSLMSITDEVVETP
KPFIPSFFFSFEIMFVPKYVYLGHGQQELVGLESLVNKRAIAFDHSVPHVIEEDDEGSPV
LLRTPKHDSTEGVAGDWKQASQPHQPHYVVPPQLQLTTWDGLNPYQILRCYFGHGREWLL
APDCYIPNSVIRARLWPEGSPIFLQCSLHAPQRELEWDKPPQFFWHSRVRALSNVEYPEE
KEDEDFLGMRISKEPTYSVLTDTTNRSWLGRKMSEIAVNSLIETILSVMIHASPLKYQCC
VGALRQIFASYQVSPSLRSETAHRLLDDTTNSNPQIRELAWEGLKCLGMITHLFALPLAQ
GLMDKDQRVRTKALGLMGDIGVHSKASLLEVIQKKETFRDMQMEMIGEESLDHLLGMRPT
DLQILQAQVEQRLNENLTLSGDKKPDFSLEVSMANEAMYLPTQLHTVGEESGMTIKPSKA
PKRGRGIGKKQTRKLLRSLKKKEVDLKLMITEPIDKEVESELSEAAPFEILDDASIHSKM
ASVSSIKFSREAESSEEDVSKDHVALTMKVLRKVHDKKDKKATVQKPTKGHKKKKKEDKG
IIEESQPTLVERQIVKKAKAQGRGVSGVPGYKRPHGRGSSWRDDLCRLMVLRVSESQTKL
SEALNTELVTMAKEILADRFPSWELFQELCPILKKESKVTMEDLDWDVIWQEEKPRFIHE
EIISEDIVIRDKEEEQKKEE
Download sequence
Identical sequences ENSOPRP00000007138 ENSOPRP00000007138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]