SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007397 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007397
Domain Number 1 Region: 153-300
Classification Level Classification E-value
Superfamily Glutaminase/Asparaginase 7.07e-34
Family Glutaminase/Asparaginase 0.0000326
Further Details:      
 
Domain Number 2 Region: 8-62
Classification Level Classification E-value
Superfamily Glutaminase/Asparaginase 0.000000000000144
Family Glutaminase/Asparaginase 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000007397
Domain Number - Region: 342-378
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000325
Family Ankyrin repeat 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007397   Gene: ENSOPRG00000008087   Transcript: ENSOPRT00000008085
Sequence length 378
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3727:631:5940:1 gene:ENSOPRG00000008087 transcript:ENSOPRT00000008085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSPASPSQRVIYTVLECQRLFDSSDMTITEWVQIAQTIQRHYEQYHGFVVVHGTDTAFAT
SVLSFVLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSWELVRRASRQGRLVVHSGMERDVGLLRL
YPGIPAALVRAFLQPPLKGVVMETFGSGNGPSAPDLLQELRAATARGLLIVSCTHCLQGT
VTSDYATGTAMAGTGIVSGFDMTSEAALAKLSYVLGQPGLSLDQRKELMTTDLRGEMTLP
VIDRCLRSPQGSVLGRGLAWLLGLGNDQEADAVRDALVPSLACAVAHSGDLEALQVLMEL
GTDLCLKDFRGQSPLHAA
Download sequence
Identical sequences ENSOPRP00000007397 ENSOPRP00000007397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]