SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007506 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007506
Domain Number 1 Region: 51-110
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000864
Family HLH, helix-loop-helix DNA-binding domain 0.0072
Further Details:      
 
Domain Number 2 Region: 383-419
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000044
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000007506
Domain Number - Region: 156-184
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00586
Family BphP N-terminal domain-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007506   Gene: ENSOPRG00000008184   Transcript: ENSOPRT00000008205
Sequence length 930
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2964:487124:1262328:1 gene:ENSOPRG00000008184 transcript:ENSOPRT00000008205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAPAKPSFEPDHSGGVRITAQHLPNQSECRKYRYDGIYCESTYQNLQALRKEKSRDAARS
RRGKENFEFYELAKLLPLPAAITSQLDKASIIRLTISYLKMRDFANQGDPPWNLRMEGPP
PNTSVKVIGAQRRRSPSALAIEVFEAHLGSHILQSLDGFVFALNQEGKFLYISETVSIYL
GLSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXLNKGQCVTKYYRWMQKNGGYIWIQSSATIAINAKNAN
EKNIIWVNYLLSNPEYKDTPMDIAQLPHLPEKTSESSETSDSESDSKDTSGTAEDNENSK
SDEKGNQSENSEDPEPDRKKSGNACDNDMNCNDDGHSSSNPDSRDSDDSFEHSDFENPKA
TEDGFGALGPMHIKVERYVESESDLRLQNCESLTSDSAKDSDSAGEAGAQASSKLQKRKK
RRKRQKGGSASRRRLSSASSPGGLDAAAAGLVEPPRLLSSPHSASVLKIKTEISEPINFD
NDSSIWNYAYREIRNESPYSMTPNSEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNILGPFGSAGSASGLTQVPGVNVF
DTAEGLFSTLPFPVYSNSIHAAQTLERKED
Download sequence
Identical sequences ENSOPRP00000007506 ENSOPRP00000007506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]