SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007621 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007621
Domain Number 1 Region: 3-138
Classification Level Classification E-value
Superfamily Eukaryotic RPB5 N-terminal domain 1.16e-31
Family Eukaryotic RPB5 N-terminal domain 0.00079
Further Details:      
 
Domain Number 2 Region: 135-208
Classification Level Classification E-value
Superfamily RPB5-like RNA polymerase subunit 1.01e-27
Family RPB5 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007621   Gene: ENSOPRG00000008331   Transcript: ENSOPRT00000008326
Sequence length 209
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_699:334:4965:-1 gene:ENSOPRG00000008331 transcript:ENSOPRT00000008326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCXXXXXXXXXXXXXXXXXXXXXXXXXSLVD
MAPKYVLEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLREQLPRIQAGDPVAR
YFGIKRGQVVKIIRPSETAGRYITYRLVQ
Download sequence
Identical sequences ENSOPRP00000007621 ENSOPRP00000007621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]