SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007745 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007745
Domain Number 1 Region: 80-155
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 9.16e-18
Family Ribosomal protein L11, C-terminal domain 0.00087
Further Details:      
 
Domain Number 2 Region: 18-42
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 0.0000759
Family Ribosomal L11/L12e N-terminal domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007745   Gene: ENSOPRG00000008471   Transcript: ENSOPRT00000008460
Sequence length 193
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4197:102660:118473:-1 gene:ENSOPRG00000008471 transcript:ENSOPRT00000008460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKLSRASRALRKPEAGGVIRTIVRAGQAMSGPPLGPILGQXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXPDRSFEIKIGQPTVSCFLKAAAGIEKGARQTGKEFAGLVTLKHVYEI
ARVKAKDDAFALLDVPLSSVVRSIIGSARSVGIRVVKDLRAEELAAFQKEWAAFLAAQKE
ADLAAAQAEVAKK
Download sequence
Identical sequences ENSOPRP00000007745 ENSOPRP00000007745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]