SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007854 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007854
Domain Number 1 Region: 120-166,307-365
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.41e-22
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.00026
Further Details:      
 
Domain Number 2 Region: 920-966
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 0.00000000000000235
Family Nuclear receptor coactivator interlocking domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007854   Gene: ENSOPRG00000008579   Transcript: ENSOPRT00000008582
Sequence length 1441
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_553:8861:98066:1 gene:ENSOPRG00000008579 transcript:ENSOPRT00000008582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGLGDSSSDPANPDSHKRKGSPCDTLASXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEAARRNSHTFNCRMLIHPPEEPGAETPEACQRYEVMQCFTVSQPRSIQEDGEDFQ
SCLICIARRLPRPPAITGVESFMTKQDTTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDTNSGMSIPRVNASVNPSVSPAHGVGRSSTLPPSNSNMGSARVNR
QQSSELHSSSHSNSSNSQGSFGCSPANQIVTNVALNQGQTSSQSSNPSLNLNNSPVEGTG
ISLAQFMSPRRQVTSGLTTRSRMPNSSFPPNIPTLNSPVGMTSSACNNNSNRSYSNIPVP
SLQGVNEGSSNSISFSASSPVLRQMTSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSD
NSAADGKPLDSALLHNSDRLSDGDSKHAQTSHKLVQLLTTTAEQQLCHADIDTSCKDVLS
CTGTSNSGLTNSSGGSCSSSHSRLTEWHKILHQLLQQGSHSDIFTLSVEPDKNDSASISV
AVTKQVQGNASIKLELDASRKKESKDHQLLRYPLDKDEKDLRSTPNLSLDDMKFKVEKKE
QMEPCNTNPPLVTKPAPEKVKLESQSQFTADLDQFDQLLPTLEKAAQLPGLCETDRMDGT
VTSVTIKSEVLPASLQSTTARPTARLNRLPDLELEAIDNQFGQPGAGDQIPWANNTVAVN
QNKPEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKL
VQGGGLDMLSDRFPPQQAAAPLMMEERPNLYSQPYSSPSPTANLPSPFQGMVRQKPSLGS
MPVQVTPPRGAFSPGMGMQPRQTLTRPPAAPNQLRLQLQQRLQGQQQLIHQNRQALLNQF
AATTPVGINMRSGIQQQITPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVFSQAVPNQPTPAQPGVYNNMSITVS
MAGGSTGVQNMNPMMGQMQMSSLQMPGMNTVCPDQMNDPSLRHPGLYCSQLSSTDLLKTE
ADGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQRLLT
E
Download sequence
Identical sequences ENSOPRP00000007854 ENSOPRP00000007854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]