SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007892 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007892
Domain Number 1 Region: 2-62,200-257
Classification Level Classification E-value
Superfamily DNA clamp 1.37e-39
Family DNA polymerase processivity factor 0.00006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007892   Gene: ENSOPRG00000008632   Transcript: ENSOPRT00000008622
Sequence length 261
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4878:73181:75044:-1 gene:ENSOPRG00000008632 transcript:ENSOPRT00000008622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSGGVNLQSMDSSHVSLVQLTLRSEGFDTY
RCDRNLAMGVNLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXVSIDMNEPVQLTFALRYLNFFTKATPLSPTVTLSMSADVPLVVEYK
IADMGHLKYYLAPKIEDEEGS
Download sequence
Identical sequences ENSOPRP00000007892 ENSOPRP00000007892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]