SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007974 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007974
Domain Number 1 Region: 1-60
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000000000284
Family Methyl-CpG-binding domain, MBD 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007974   Gene: ENSOPRG00000008719   Transcript: ENSOPRT00000008711
Sequence length 252
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4471:9499:10954:-1 gene:ENSOPRG00000008719 transcript:ENSOPRT00000008711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSGKKFRSKPQLARYLGGSVDLSTFDFRTGKMLLSKVTKSRQRVRYDSANQVKGKPDLNT
ALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVEQPRQLFWEKKLSGLNAFDIAXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXSALHTSTLPVTGQLSAAVEKNPGVWLNTTQPLCRA
FMVTDEDIRKQEELVQQVRKRLEEALMADMLAHVEELARDGEAPLDKACGDEDEEEDDDD
EEPEPDREMEPV
Download sequence
Identical sequences ENSOPRP00000007974 ENSOPRP00000007974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]