SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000008195 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000008195
Domain Number 1 Region: 154-216
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 5.89e-20
Family HLH, helix-loop-helix DNA-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000008195   Gene: ENSOPRG00000008973   Transcript: ENSOPRT00000008953
Sequence length 356
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3008:601683:602753:1 gene:ENSOPRG00000008973 transcript:ENSOPRT00000008953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLLHAEEWAEVKELGNHHRHPQPHHLSPPPPPQPPAALQAREHSIYPTELSLLNSTDP
RAWLAPTLQGICTTRAAQYLLHSPDLGASEAAVPRDEADARGELARRSGGGSSKSPGPVK
VREQLCKLKGGVVVEELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLR
NVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPNGGEQPPPPPPPPPPASCKSDHHHL
RAGAPYESSVGPAPTAGAPPGSGGGPRPAPPGSCRTRFSSQASAGGYTVQLDALHFSAFE
DSALTAMMAQKNLSPTLPGGILPPVAEESSKTSPRSHRSDGEFSPHSHYSDSDEAS
Download sequence
Identical sequences ENSOPRP00000008195 XP_004590624.1.84141 ENSOPRP00000008195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]