SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000008229 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000008229
Domain Number 1 Region: 92-166
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.36e-18
Family HLH, helix-loop-helix DNA-binding domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000008229   Gene: ENSOPRG00000008999   Transcript: ENSOPRT00000008990
Sequence length 242
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2463:54253:55500:1 gene:ENSOPRG00000008999 transcript:ENSOPRT00000008990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMMDLFESGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQIPPEAGSDSSGEE
HVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRT
VSNPNQRLPKVEILRSAISYIERLQDLLHRLDQQEKMQELGVDPFNYRPKQETLEGADFL
RTCSSQWPSVSDHSRGLLITAKEGGASVDSSASSSLRCLSSIVDSISSEERKLPCAEEVV
EK
Download sequence
Identical sequences ENSOPRP00000008229 ENSOPRP00000008229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]