SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000008315 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000008315
Domain Number 1 Region: 683-904
Classification Level Classification E-value
Superfamily ALDH-like 3.93e-74
Family ALDH-like 0.000000679
Further Details:      
 
Domain Number 2 Region: 23-223
Classification Level Classification E-value
Superfamily Formyltransferase 4.06e-49
Family Formyltransferase 0.0000000189
Further Details:      
 
Domain Number 3 Region: 469-622
Classification Level Classification E-value
Superfamily ALDH-like 5.5e-43
Family ALDH-like 0.0000119
Further Details:      
 
Domain Number 4 Region: 227-327
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 1.02e-24
Family Post formyltransferase domain 0.0000132
Further Details:      
 
Domain Number 5 Region: 341-424
Classification Level Classification E-value
Superfamily ACP-like 0.00000445
Family Acyl-carrier protein (ACP) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000008315   Gene: ENSOPRG00000009073   Transcript: ENSOPRT00000009087
Sequence length 923
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5020:588236:633644:-1 gene:ENSOPRG00000009073 transcript:ENSOPRT00000009087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGGGQALRRFSTSPIYLKNKLKLALIGQSLFGQEVYSHLRKEGHRVVGVFTVPDKDGK
ADPLALAAEKDGTPVFKFPRWRVKGKTIQEVVEAYRSVGAELNVLPFCTQFIPMDVIDGP
KHGSIIYHPSILPRHRGASAINWTLIMGDKKAGLSVFWADDGLDTGPILLQRSCDVQPND
TVDTLYNRFLFPEGIKAMVEAVQLIADGKAPRTAQPEEGATYEGIQRKENAKIFWDQPAE
ALHNWIRGHDKVPGAWTEINGQVVTFYGSSLLTSSVPPGEPLEIKGAEKPGLVTKNGLVL
YGNDGKALVVRNLQFEDGRMIPASQYFSVGETAMLELTTEEEEVAETIRVIWAGILSNVR
VIEDSTDFFKSGASSMDVVRLVEEIRQKCGGLQLQNEDVYMATRFEDFIQKVVRKLRGED
HEAELVVDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVICKVSYASLV
DVDKAVAAAKDAFENGEWGRMNARDRGRLMYRLADLLEEHQEELATIEALDSGAVYTLAL
KTHIGMSVQTFRYFAGWCDKIQGSTIPINQARPNHNLTFTKKEPLGVCAIIIPWNYPLMM
LAWKSAACLAAGNTLVLKPAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXCAVSNLKKVSLELGGKSPLIIFNDCELDKAVRMGMGAV
FFNKGENCIAAGRLFVEEAIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLL
QYCEAGVKEGATLVYGGRQVQRPGFFMEPTVFTDVEDHMYLAKEESFGPIMVISKFQNGD
IDGVLQRANNTEYGLASGVFTRDINKAMYVSEKLEAGTVFINTYNKTDVAAPFGGVKQSG
FGKDLXXXXXXXXXXXXXVTLEY
Download sequence
Identical sequences ENSOPRP00000008315 ENSOPRP00000008315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]