SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000008435 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000008435
Domain Number 1 Region: 35-139
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 1.7e-39
Family Nucleoplasmin-like core domain 0.0000818
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000008435   Gene: ENSOPRG00000009229   Transcript: ENSOPRT00000009219
Sequence length 177
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1090:75991:77353:-1 gene:ENSOPRG00000009229 transcript:ENSOPRT00000009219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGAAAALAVLSQESRGRTGAVGPLRIPAPVTMDSFFFGCELSGQTRAFTFKVEQEDDA
EHVLALTMLCLTEGAKEECNVVEVVARSHDHQEIAVPVANLRLSCQPMLSLDDFQLQPPV
TFRLKSGSGPVRITGRHQIVTISNDVSEEEESEEEESDGEDAELCPILPAKKQGGRS
Download sequence
Identical sequences ENSOPRP00000008435 ENSOPRP00000008435 XP_004579990.1.84141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]