SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000008481 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000008481
Domain Number 1 Region: 350-615
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.52e-83
Family Eukaryotic proteases 0.0000000129
Further Details:      
 
Domain Number 2 Region: 105-191
Classification Level Classification E-value
Superfamily Kringle-like 9.91e-31
Family Kringle modules 0.0000157
Further Details:      
 
Domain Number 3 Region: 45-104
Classification Level Classification E-value
Superfamily GLA-domain 2.69e-18
Family GLA-domain 0.0000723
Further Details:      
 
Domain Number 4 Region: 254-294
Classification Level Classification E-value
Superfamily Kringle-like 0.00000058
Family Kringle modules 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000008481   Gene: ENSOPRG00000009249   Transcript: ENSOPRT00000009268
Sequence length 618
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4227:114947:127734:1 gene:ENSOPRG00000009249 transcript:ENSOPRT00000009268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRHVRGLRLADCLALATLAGLVCSQHVFLAPERALSLLQRNRRANKGFLEELRKGNLERE
CIEEPCSYEEAFEALESSSSTDAFWVNYTVCEPVRKPRETLMDCLEGRCSQGLGINYRGK
VSITQSGIECQLWRSRYPHNPEINSTTHPEADLQENFCRNPDGSGTGPWCYTTDPTLRRE
TCNVPICXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXPQVRLLQNYCNDAEGAWCYVAGRPDDFEYCDLHYCEENVEEEDGP
EGGPEEVIEGRTTEQEFQTFFDQKTFGEGEADCGLRPLFEKKSVKDATEDELFESYIDGR
IVKGQDAEKGSAPWQVMIFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTINDIL
VRIGKHNRNXXXXXXXXXXXXXXXXXXXXYNWRVNLDRDIALLKLKKPVAFSDYIHPVCL
PDKRVVNRLFQAGYKGRVTGWGNLKETWTVTMNEVQPNVLQTVNLPLVEGPVCKASTRIR
ITDNMFCAGYKPEEETRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFY
THVFRLKKWIRKVVDRYG
Download sequence
Identical sequences ENSOPRP00000008481 ENSOPRP00000008481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]