SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000008524 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000008524
Domain Number 1 Region: 2-269
Classification Level Classification E-value
Superfamily ALDH-like 9.56e-81
Family ALDH-like 0.0000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000008524   Gene: ENSOPRG00000009320   Transcript: ENSOPRT00000009314
Sequence length 281
Comment pep:known_by_projection scaffold:pika:scaffold_15009:984:16759:-1 gene:ENSOPRG00000009320 transcript:ENSOPRT00000009314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAMARDERVNLLSFTGSTQVGKQVALMVQERFGRSLLELGGNNAIIAFEDADLSLVVPSA
LFAAVGTAGQRCTTARRLFLHENIHDEVVNRLTKAYAQIRVGNPWDPDVLYGPLHTRQAV
SMFLAAVEEAKKEGGTVVYGGKVMDRSGNYVEPTIITGLAHDAAIAHTETFAPILYVFKF
KDEEEVFAWNNEVKQGLSSSIFTKDLGRIFHWLGPRGSDCGIVNVNIPTSGAEIGGAFGG
EKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ
Download sequence
Identical sequences ENSOPRP00000008524 ENSOPRP00000008524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]