SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000008649 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000008649
Domain Number 1 Region: 153-204
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000471
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000008649   Gene: ENSOPRG00000009458   Transcript: ENSOPRT00000009455
Sequence length 274
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_49:73162:74712:-1 gene:ENSOPRG00000009458 transcript:ENSOPRT00000009455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPPQAQAEVGPTMTEKAQIMACAPSPEAPSLPPKSPSPGPLQATVVEEGGHRDPCSSPR
LPPGVPVISLGHTRPPGAAMPPTELSAFPLPLLQLSTLGAAPPALSLHYHPHPFLNSVYI
GPAGAFTLLPNSRLKRRPSHGELDLADHQPHKVARRVFTNSRERWRQQNVNGAFAELRKL
LPTHPPDRKLSKNEVLRLAMKYIGSRALHDQAASAGAPFGAGKRLRLRGGLESRRKSAGA
ARTQPAPPADLDDSPGAGARAIKMEQAALSPEVR
Download sequence
Identical sequences ENSOPRP00000008649 ENSOPRP00000008649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]